Met store.

The Met Store offers a selection of gifts inspired by current exhibitions and The Met’s unparalleled collection of more than 5,000 years of art from around the world. The store has a presence in all three of the Museum’s iconic sites in New York City—The Met Fifth Avenue, The Met Breuer, and The Met Cloisters—and online at store ...Nov 6, 2022 · Description. Wear and share your love of art with pride. This oh-so-comfortable hooded sweatshirt is emblazoned with "Metropolitan Museum of Art New York" in "collegiate" typeface, and features a double-layer hood with a drawcord plus a handy front pouch pocket. Details. Shipping & Returns. The Met Fifth Avenue. Over 5,000 years of art from around the world. Open today 10 am–9 pm. Hours: 10 am–5 pm. Extended Hours: Fri. and Sat., 10 am–9 pm. Closed: Wednesday. Closed Thanksgiving Day, December 25, January 1, and the first Monday in May. Auguste Rodin: The Thinker Sculpture. $245.00. QUICK VIEW. Giambologna: Owl Sculpture. $58.00. QUICK VIEW. Sort by Recommended. Bring the Met Museum into your home with sculptural reproductions based on art from the ancient world, Impressionism, and beyond. The Metropolitan Museum Of Art Store. The Metropolitan Museum of Art Store Australia has gifts for everyone, ranging from jewellery to children's gifts, textiles, stationery, ceramics and sculpture. For elegant and timeless gifts with a history, please enjoy browsing our site www.themetstore.com.au or visit one of our stores.

Our eye-catching glass frame borrows the decorative motif on a Favrile glass vase (ca. 1906) designed by Louis Comfort Tiffany (American, 1848–1933) and housed at The Met. In the late 19th century, the Gilded Age visionary developed a method of blending colors in molten glass, thus achieving subtle effects of shading and texture.An art-inspired gift for the home. This striking sculpture reproduces Unique Forms of Continuity in Space, a monumental bronze sculpture created by the Italian Futurist Umberto Boccioni (Italian, 1882–1916) in 1913 and cast in 1950.The work's dynamism and energy reflects the Futurists's celebration of the fast pace and mechanical power of the modern …Free Admission for 2 Member cardholders and 2 guests every visit (and children under 18) 30% off initial order, excluding clearance and sale merchandise, when Membership is purchased at The Met Store. 15% off at The Met Store, after initial Membership purchase, plus seasonal double discounts. Access to The Balcony Lounge.

Void where prohibited. Royal Tudor Pearl and Chain Necklace. 80056444New. Item #80056444. Price: 95$95.00. Member Price: 80.75$80.75. In Stock. This sophisticated necklace elevated with cultured freshwater pearls celebrates the splendid adornments worn by Ellen Maurice in Marcus Gheeraerts the Younger's... View Full Product Details.Shopping Tools Gift Cards Memberships Met Opera Live in HD Met Opera On Demand My Account Pick Up in Store; Ordering Info Size Charts FAQ Promotional Restrictions Content Advisory Purchase Tickets to the Opera; Customer Support Order Status Returns & Exchanges Shipping Info International Shipping; Contact Us Phone Live Chat Email

A Met Museum publication is the perfect gift for art lovers. Edited by Denise Murrell Beginning in the 1920s, Upper Manhattan became the center of an explosion of art, writing, and ideas that has since become legendary.The final performance of “Forza,” on Friday, with be Carfizzi’s 459th at the Met. Ali Cherkis for The New York Times. Carfizzi grew up in Newburgh, N.Y., about 60 miles … The Met Store Gift Finder Your purchase supports The Met's collection, study, conservation, and presentation of 5,000 years of art. Sign up for Met Store emails & save 10% & Accessories. Scarves. Clothing. Bags. Small Accessories. Umbrellas. All Clothing. & Accessories. Explore Top Sellers. Louis C. Tiffany Irises Oblong Silk Scarf. $69.00. Quick view. Louis C. Tiffany Peonies Silk …

Erté Monte Carlo Drop Earrings. $125.00. QUICK VIEW. Erté Rayonnement Drop Earrings. $105.00. QUICK VIEW. Explore items inspired by the work of Erte. The Met Store is proud to present apparel, jewelry, décor & more inspired by the world's great artists.

The Met Store offers a selection of gifts inspired by current exhibitions and The Met’s unparalleled collection of more than 5,000 years of art from around the world. The store has a presence in all three of the Museum’s iconic sites in New York City—The Met Fifth Avenue, The Met Breuer, and The Met Cloisters—and online at store ...

The Metropolitan Museum Of Art Store. The Metropolitan Museum of Art Store Australia has gifts for everyone, ranging from jewellery to children's gifts, textiles, stationery, ceramics and sculpture. For elegant and timeless gifts with a history, please enjoy browsing our site www.themetstore.com.au or visit one of our stores.Price: $150.00. Member Price: $127.50. Size Guide. Qty. Add to Bag. Add to Wishlist. Description. This delicate pendant embellished with freshwater pearls references a gold-and-pearl cross made in the Philippines between the 17th and 19th centuries. This eye-catching charm evokes the many timeless emblems of faith in the …The Metropolitan Museum of Art Store's selection of art-themed museum jewelry includes art-inspired watches, artistic earrings, fashion bracelets, statement earrings, stylish …Emine Sinmaz. The former Met police officer accused of botching the Wayne Couzens flashing case has admitted she made some mistakes, but said nothing she could have done would have changed the ...Next open tomorrow at 10 am. Hours: Sunday–Tuesday and Thursday: 10 am–5 pm. Extended Hours: Friday and Saturday: 10 am–9 pm. Closed: Wednesday. Closed Thanksgiving Day, December 25, January 1, and the first Monday in May.Winslow Homer, Northeaster Faith Ringgold, Freedom of Speech Paul Cézanne, The Gulf of Marseilles Seen from L'Estaque Edouard Vuillard, Garden at Vaucresson Romare Bearden, Tapestry "Recollection Pond" Camille Pissarro, The Boulevard Montmartre on a Winter Morning Henri Rousseau, The Repast of the Lion Edgar Degas, The Dance …

An art-inspired gift for the home. This striking sculpture reproduces Unique Forms of Continuity in Space, a monumental bronze sculpture created by the Italian Futurist Umberto Boccioni (Italian, 1882–1916) in 1913 and cast in 1950.The work's dynamism and energy reflects the Futurists's celebration of the fast pace and mechanical power of the modern … Quick view. Build-A-Bear Monet Water Lilies Bear Plush. $36.95. Quick view. Van Gogh Roses Tumblers. $58.00. Quick view. Casely Monet Bridge and Water Lilies Power Pod Wireless Charger. $80.00. The Met Store is set to re-release the legendary 2015 “The Call of Ktulu” print on Thursday, March 21, at 1:00 PM PT, now with metallic ink. This exclusive release will help fund Richey Beckett’s recovery from emergency eye surgery. read …Call centre hours. Customer Service and Sales Office. Agencies in Abu Dhabi – UAE. MetLife Gulf Operations. Offices in Bahrain, Kuwait, Oman & Qatar. Rest of the Region …Delight your little ones with this Museum-inspired jack-in-the-box toy. Wind it up and out pops an adorable plush unicorn, inspired by the mythological animal depicted in The Unicorn Rests in a Garden (1495–1505) at The Met Cloisters. Belonging to the Unicorn Tapestries, a series of seven celebrated medieval hangings, this French …Free Admission for 2 Member cardholders and 2 guests every visit (and children under 18) 30% off initial order, excluding clearance and sale merchandise, when Membership is purchased at The Met Store. 15% off at The Met Store, after initial Membership purchase, plus seasonal double discounts. Access to The Balcony Lounge.The Met Fifth Avenue. Over 5,000 years of art from around the world. Hours: Sunday–Tuesday and Thursday: 10 am–5 pm. Extended Hours: Friday and Saturday: 10 am–9 pm. Closed: Wednesday. Closed Thanksgiving Day, December 25, January 1, and the first Monday in May.

QUICK VIEW. Best Seller. Midnight Garden Notecards. $15.00. QUICK VIEW. Sort by Recommended. Art notecards from The Met Store are a great gift option for anyone on your gift list. Gifts for her or gifts for him, both are at your fingertips with elegant art-inspired stationery. Be sure to browse for leather-bound journals or …

2024 Gift Guide | The Met Store. Free standard shipping on orders of $100 or more. Shop now. See details . Gift Guide. Artful Gifting. Special occasion gifts for art lovers. Shop …Shipping & Returns. Standard flat-rate shipping (3–8 days) $12.95. Expedited US shipping (2 days) $13.95 extra. Overnight shipping. $22.95 extra. Skip to the end of the images gallery. Shop now for the Met Facade Folding Umbrella and other accessories, all inspired by the The Met's extensive collection.The Met Store's assortment of art books and other Met Museum gifts features everything you need to brush up on your art history, dive deep into a research project, revisit the Museum's exhibitions, or simply bring the beauty of art into your home through exquisite, full-color coffee table books.The Met Museum bookstore's art catalogues, fashion books, art …Unearth auspicious rewards with the latest Battle Pass. Pirates, magic & mayhem! Join the limited-time event. Subscribe Now. Battle.net is your one stop shop into the world of Blizzard and Activision. Buy digital games, in-game items, balance and more for all of your favorite ...Price: $69.00. Member Price: $58.65. Qty. This item is expected to ship in late March. Add to Bag. Add to Wishlist. Description. This scarf presents a detail of Camille Monet in the Garden at Argenteuil in The Met collection, which was painted in 1876 by Claude Monet (French, 1840–1926). Central to the painting's composition is a stand of ...Welcome to the official Hypixel Store! This is the place for you to enhance your Hypixel Server experience. We offer ranks, Hypixel Gold, SkyBlock Gems, and more. You can choose the product category in the site navigation at the top or by clicking on the category list above. All payments are handled and secured by Tebex. The Met Store’s custom print service offers four sizes and both fine-art paper or heavy cotton canvas, hand stretched over wood stretcher bars. Using only archival-quality pigment inks from high-resolution, large-format, 12-color printers, the quality of these art prints is unmatched. Using gallery-quality materials, the prints from The Met ... Next open tomorrow at 10 am. Hours: Sunday–Tuesday and Thursday: 10 am–5 pm. Extended Hours: Friday and Saturday: 10 am–9 pm. Closed: Wednesday. Closed Thanksgiving Day, December 25, January 1, and the first Monday in May.

Shop Meta Quest, Ray-Ban Stories, and VR accessories. Discover Meta’s revolutionary technology from virtual reality to social experiences. Shop Meta Quest, Ray-Ban Stories, and VR accessories. Special offer Expand your world with Meta Quest 3 Mixed reality starting at $499.99 USD. Add to bag ...

Sort by Recommended. Member with Early Views. $110.00. QUICK VIEW. Member with Evening Hours. $210.00. QUICK VIEW. Member with Opening Nights. $600.00.

Next open tomorrow at 10 am. Hours: Sunday–Tuesday and Thursday: 10 am–5 pm. Extended Hours: Friday and Saturday: 10 am–9 pm. Closed: Wednesday. Closed Thanksgiving Day, December 25, January 1, and the first Monday in May.The Met Store is set to re-release the legendary 2015 “The Call of Ktulu” print on Thursday, March 21, at 1:00 PM PT, now with metallic ink. This exclusive release will help fund …Avian Holiday Pop-Up Advent Calendar. $24.95. QUICK VIEW. Plexiglass Stand for Calendar Refills. $14.00. QUICK VIEW. Sort by Recommended. Adding beautiful art to your home is easy with The Met Store’s collection of art-inspired calendars. Select from art wall calendars of your favorite masterworks or desk calendars featuring paintings from ... Willow Catkins Pearl Bib Necklace and Drop Earrings Set. $260.00. QUICK VIEW. Golden Disc Necklace and Huggie Earrings Set. $250.00. QUICK VIEW. Stylish necklaces and statement earrings stand out on their own—and are truly stunning as a set. Our elegant fashion-jewelry sets are based on finely detailed objects from The Met collection, and our ... QUICK VIEW. Best Seller. Midnight Garden Notecards. $15.00. QUICK VIEW. Sort by Recommended. Art notecards from The Met Store are a great gift option for anyone on your gift list. Gifts for her or gifts for him, both are at your fingertips with elegant art-inspired stationery. Be sure to browse for leather-bound journals or …Met Custom Prints and The Met Store, by You purchases are individually made to order and cannot be returned or exchanged. In the event that you receive the incorrect order, or your item arrives defective or damaged, please contact us at [email protected] or call 800-662-3397, Monday–Friday, 9 am-5 pm …France will provide over 30 million euros ($32.41 million) to United Nations Palestinian refugee agency UNRWA this year to support its operations amid the …Partners and Advisers. How we can support you. Ethics and Fraud Hotline. DHA-F-0001362. AL BARSHA ROAD, TAMIMI HOUSE. MEDICINA AL FAHIDI PHARAMCY. NICE LIFE …The Gallery at The Met Store. All Home Decor. Best Sellers. New Arrivals. Shop top-rated home decor Van Gogh Irises Glass Vase. $30.00. Met Custom Prints↗ ...Met Foodmarkets, also referred to as Met Foods, is a group of independently owned and operated stores, which operates in the New York Metropolitan Area. Most of its stores are in the four boroughs of New York City outside Manhattan and carry a variety of products.

The Met Store’s custom print service offers four sizes and both fine-art paper or heavy cotton canvas, hand stretched over wood stretcher bars. Using only archival-quality pigment inks from high-resolution, large-format, 12-color printers, the quality of these art prints is unmatched. Using gallery-quality materials, the prints from The Met ...QUICK VIEW. Best Seller. Midnight Garden Notecards. $15.00. QUICK VIEW. Sort by Recommended. Art notecards from The Met Store are a great gift option for anyone on your gift list. Gifts for her or gifts for him, both are at your fingertips with elegant art-inspired stationery. Be sure to browse for leather-bound journals or …Shop the Metallica live show catalog. Join Our Free Fan Club to Become a Fifth Member Purchase prints and custom framed reproductions of art works from The Metropolitan Museum of Art. All purchases help support The Metropolitan Museum of Art. Shop The Met Store Instagram:https://instagram. hot pilatesukrainebridesagencyamakafranklinplanner The Met presents over 5,000 years of art from around the world for everyone to experience and enjoy. ... Shop The Met Store. More to Explore Online. neousthe pie pizzeria The Met presents over 5,000 years of art from around the world for everyone to experience and enjoy. ... Shop The Met Store. More to Explore Online. us.kozy Price: $125.00. Member Price: $106.25. ColorBurgundy. Item # 80056280. Qty. Add to Bag. Add to Wishlist. Description. The splendid design on this artful scarf is borrowed from a 16th-century fragment of damask boasting ovoid forms, garland leaves, and a diamond ring emerging from a crown bearing three pears. Mexican Sampler Zip Pouch. $25.00. QUICK VIEW. Roesen Still Life Zip Pouch. $25.00. QUICK VIEW. Sort by Recommended. The Met Store is your destination for art-inspired bags, whatever the occasion. Brightly printed, head-turning styles feature works from The Met collection and images inspired by the Museum's acclaimed exhibitions and make the ... 72 Seasons Digital Download. $11.99 - $19.99. DISCOUNT EXCLUSION. Metallica (The Black Album) Remastered - Deluxe Box Set. $239.98. DISCOUNT EXCLUSION. Live Metallica: Detroit, MI - M72 Tour Two Day Show CD Bundle. $49.99. DISCOUNT EXCLUSION.